2.45 Rating by CuteStat

vsmglobalexim.com is 6 years 11 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, vsmglobalexim.com is SAFE to browse.

PageSpeed Score
47
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

103.24.200.143

Hosted Country:

India IN

Location Latitude:

21.9974

Location Longitude:

79.0011

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: 2
H5 Headings: 1 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 2
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 103.24.200.143)

web designing company Hyderabad, web designing in Hyderabad ,web desig

- outlinedesigns.in

web Design Company Hyderabad , Affordable Web site designer, web application development and Solutions company, website developers, Web Designing Company Hyderabad, web designing in Hyderabad ,Vijayawada, web design services Hyderabad, website design services Hyderabad

Not Applicable $ 8.95

.:: Immigration Assistance|Infrastructure|Project Management|Applicati

- eforcesol.com

Immigration Assistance,Infrastructure,Project Management,Application Development,ERP,CRM,Engineering Services,QA Testing,eForce Solutions

Not Applicable $ 8.95


.:: SRI SUBRAHMANYASWAMY DEVALAYAM SKANDAGIRI ::.

- srisubrahmanyaswamydevalayamskandagiri.org
1,706,079 $ 720.00

Medinova, Kolkata: serology, endocrinology, ultrasound investigations

- medinovaindia.com

Medinova Diagnostics: aematology, micro-biology, histopathology, serology, endocrinology, ultrasound investigations imaging systems, colour dopplers, ECG Machines, cardiac stress system, blood test, CT scan, MRI Scan. lab, radiology, imageology, cardiology gastroscopy, aematology, micro-biology, histopathology, serolog

5,159,456 $ 240.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 14 May 2017 07:01:04 GMT
Server: Apache
Last-Modified: Fri, 12 May 2017 22:22:32 GMT
Accept-Ranges: bytes
Content-Length: 15665
Content-Type: text/html

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: May 12, 2017, 12:00 AM 6 years 11 months 1 day ago
Last Modified: May 12, 2017, 12:00 AM 6 years 11 months 1 day ago
Expiration Date: May 12, 2018, 12:00 AM 5 years 11 months 1 week ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

DNS Record Analysis

Host Type TTL Extra
vsmglobalexim.com A 14384 IP: 103.24.200.143
vsmglobalexim.com NS 5103 Target: ns1.lazybulls.com
vsmglobalexim.com NS 5103 Target: ns2.lazybulls.com
vsmglobalexim.com SOA 86399 MNAME: ns1.lazybulls.com
RNAME: manager.catchway.com
Serial: 2017051202
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
vsmglobalexim.com MX 14399 Target: vsmglobalexim.com